PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G134100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family WOX
Protein Properties Length: 231aa    MW: 25825.8 Da    PI: 9.4774
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G134100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.9e-2195154357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  Aqcoe6G134100.1.p  95 TRWNPTQEQIGILEMLYKGgMRTPNAHQIEHITAQLgkygKIEGKNVFYWFQNHKARERQ 154
                        7*****************99**************************************97 PP

2Wus_type_Homeobox117.27.6e-3895156465
  Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        tRW+Pt+eQi iLe+lyk G+rtPn+++i++ita+L +yGkie+kNVfyWFQN+kaRerqkq
  Aqcoe6G134100.1.p  95 TRWNPTQEQIGILEMLYKGGMRTPNAHQIEHITAQLGKYGKIEGKNVFYWFQNHKARERQKQ 156
                        8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.89690155IPR001356Homeobox domain
SuperFamilySSF466891.63E-1292160IPR009057Homeodomain-like
SMARTSM003893.3E-792159IPR001356Homeobox domain
CDDcd000862.38E-595156No hitNo description
PfamPF000461.1E-1895154IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-796154IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGSSMKVHQL TRGFWDQHEP SLSLGCKRLR PLAPKLTNSD SSSSNSVIAL DLKSFIKADY  60
TSGPRKLSSN EDIIKQESAA AATTTHQLEA HSGGTRWNPT QEQIGILEML YKGGMRTPNA  120
HQIEHITAQL GKYGKIEGKN VFYWFQNHKA RERQKQKRNS LGLSHSPRTL AATTVSSSDA  180
SGEAEKEEDS QYKRKHRSWA IEYIEESNRL YGSEEGDKTL ELFPLHPEGK *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263471.11e-108PREDICTED: WUSCHEL-related homeobox 4-like
SwissprotQ6X7J99e-77WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLB9MVU11e-105B9MVU1_POPTR; Homeobox-leucine zipper transcription factor family protein
TrEMBLR9RIF31e-105R9RIF3_POPCA; WUSCHEL-related homeobox 4
STRINGPOPTR_0014s02540.11e-105(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.16e-77WUSCHEL related homeobox 4